LCP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2081584
Artikelname: LCP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2081584
Hersteller Artikelnummer: orb2081584
Alternativnummer: BYT-ORB2081584-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-LCP1 antibody is: synthetic peptide directed towards the C-terminal region of Human PLSL
Konjugation: Biotin
Alternative Synonym: LPL, CP64, PLS2, LC64P, HEL-S-37, L-PLASTIN
LCP1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 68 kDa
NCBI: 005266431
UniProt: P13796
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARK