KRT2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2081590
| Artikelname: |
KRT2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2081590 |
| Hersteller Artikelnummer: |
orb2081590 |
| Alternativnummer: |
BYT-ORB2081590-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen for Anti-KRT2 antibody is: synthetic peptide directed towards the middle region of Human K22E |
| Konjugation: |
Biotin |
| Alternative Synonym: |
K2e, KRTE, CK-2e, KRT2A, KRT2E |
| KRT2 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
70 kDa |
| NCBI: |
000414 |
| UniProt: |
P35908 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: GTRPINLEPIFQGYIDSLKRYLDGLTAERTSQNSELNNMQDLVEDYKKKY |