KLRC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2081599
| Artikelname: |
KLRC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2081599 |
| Hersteller Artikelnummer: |
orb2081599 |
| Alternativnummer: |
BYT-ORB2081599-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen for Anti-KLRC1 antibody is: synthetic peptide directed towards the N-terminal region of Human NKG2A |
| Konjugation: |
Biotin |
| Alternative Synonym: |
NKG2, NKG2A, CD159A |
| KLRC1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
25 kDa |
| NCBI: |
998823 |
| UniProt: |
P26715 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: NQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDF |
