KIR3DL2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2081605
| Artikelname: |
KIR3DL2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2081605 |
| Hersteller Artikelnummer: |
orb2081605 |
| Alternativnummer: |
BYT-ORB2081605-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen for Anti-KIR3DL2 antibody is: synthetic peptide directed towards the C-terminal region of Human KI3L2 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
3DL2, p140, NKAT4, CD158K, NKAT-4, NKAT4B, KIR-3DL2 |
| KIR3DL2 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
50 kDa |
| NCBI: |
006728 |
| UniProt: |
P43630 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: IFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTY |
