KIR2DL4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2081608
| Artikelname: |
KIR2DL4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2081608 |
| Hersteller Artikelnummer: |
orb2081608 |
| Alternativnummer: |
BYT-ORB2081608-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen for Anti-KIR2DL4 antibody is: synthetic peptide directed towards the C-terminal region of Human KI2L4 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
G9P, CD158D, KIR103, KIR-2DL4, KIR103AS, KIR-103AS |
| KIR2DL4 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
33 kDa |
| UniProt: |
Q99706 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: DEQDPQEVTYAQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRA |