KCNA2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2081620
| Artikelname: |
KCNA2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2081620 |
| Hersteller Artikelnummer: |
orb2081620 |
| Alternativnummer: |
BYT-ORB2081620-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCNA2 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
HK4, MK2, HBK5, NGK1, RBK2, DEE32, HUKIV, KV1.2, EIEE32 |
| KCNA2 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
54 kDa |
| NCBI: |
004965 |
| UniProt: |
P16389 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: AAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGD |
