IL1RAP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2081632
| Artikelname: |
IL1RAP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2081632 |
| Hersteller Artikelnummer: |
orb2081632 |
| Alternativnummer: |
BYT-ORB2081632-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen for Anti-IL1RAP antibody is: synthetic peptide directed towards the C-terminal region of Human IL1AP |
| Konjugation: |
Biotin |
| Alternative Synonym: |
IL1R3, C3orf13, IL-1RAcP |
| IL1RAP Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
62 kDa |
| UniProt: |
Q9NPH3 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: KELKRAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRRSSSDEQG |
