HSD3B2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2081650
Artikelname: HSD3B2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2081650
Hersteller Artikelnummer: orb2081650
Alternativnummer: BYT-ORB2081650-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-HSD3B2 antibody is: synthetic peptide directed towards the middle region of Human 3BHS2
Konjugation: Biotin
Alternative Synonym: HSDB, HSD3B, SDR11E2
HSD3B2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 40 kDa
NCBI: 001159592
UniProt: P26439
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIY