GNAQ Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2081704
Artikelname: GNAQ Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2081704
Hersteller Artikelnummer: orb2081704
Alternativnummer: BYT-ORB2081704-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GNAQ
Konjugation: Biotin
Alternative Synonym: GAQ, SWS, CMC1, G-ALPHA-q
GNAQ Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 002063
UniProt: P50148
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLN