CTTN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2081752
Artikelname: CTTN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2081752
Hersteller Artikelnummer: orb2081752
Alternativnummer: BYT-ORB2081752-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SRC8
Konjugation: Biotin
Alternative Synonym: EMS1
CTTN Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 69kDa
UniProt: Q14247
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDD