ELF5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2081755
Artikelname: ELF5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2081755
Hersteller Artikelnummer: orb2081755
Alternativnummer: BYT-ORB2081755-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ELF5
Konjugation: Biotin
Alternative Synonym: ESE2
ELF5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 938195
UniProt: Q9UKW6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: WEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILER