EPYC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2081791
Artikelname: EPYC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2081791
Hersteller Artikelnummer: orb2081791
Alternativnummer: BYT-ORB2081791-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human EPYC
Konjugation: Biotin
Alternative Synonym: PGLB, DSPG3, Pg-Lb, SLRR3B
EPYC Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 004941
UniProt: Q99645
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIATVMPSGNRELLTPP