CKB Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2081849
Artikelname: CKB Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2081849
Hersteller Artikelnummer: orb2081849
Alternativnummer: BYT-ORB2081849-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCRB
Konjugation: HRP
Alternative Synonym: BCK, B-CK, CKBB, CPK-B, HEL-211, HEL-S-29
CKB Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 001814
UniProt: P12277
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: TVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDD