APBB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2081902
Artikelname: APBB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2081902
Hersteller Artikelnummer: orb2081902
Alternativnummer: BYT-ORB2081902-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human APBB1
Konjugation: Biotin
Alternative Synonym: RIR, FE65, MGC:9072
APBB1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 78kDa
UniProt: O00213
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDS