UIMC1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2082165
Artikelname: UIMC1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2082165
Hersteller Artikelnummer: orb2082165
Alternativnummer: BYT-ORB2082165-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human UIMC1
Konjugation: FITC
Alternative Synonym: RAP80, X2HRIP110
UIMC1 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 79kDa
UniProt: Q96RL1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GEQASEKNECISEDMGDEDKEERQESRASDWHSKTKDFQESSIKSLKEKL