TAF9B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2082177
Artikelname: TAF9B Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2082177
Hersteller Artikelnummer: orb2082177
Alternativnummer: BYT-ORB2082177-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAF9B
Konjugation: FITC
Alternative Synonym: DN7, DN-7, TAF9L, TAFII31L, TFIID-31
TAF9B Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 057059
UniProt: Q9HBM6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM