ZBTB7B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2082191
Artikelname: ZBTB7B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2082191
Hersteller Artikelnummer: orb2082191
Alternativnummer: BYT-ORB2082191-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZBT7B
Konjugation: HRP
Alternative Synonym: CKROX, THPOK, ZFP67, ZBTB15, ZFP-67, c-KROX, hcKROX, ZNF857B
ZBTB7B Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 006711422
UniProt: O15156
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: GDRPYECHLCHKAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPS