UBXN1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2082194
Artikelname: UBXN1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2082194
Hersteller Artikelnummer: orb2082194
Alternativnummer: BYT-ORB2082194-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human UBXN1
Konjugation: HRP
Alternative Synonym: 2B28, SAKS1, UBXD10
UBXN1 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 32kDa
UniProt: Q04323
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: GRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPTSS