TALDO1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082499
Artikelname: TALDO1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082499
Hersteller Artikelnummer: orb2082499
Alternativnummer: BYT-ORB2082499-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TALDO
Konjugation: Biotin
Alternative Synonym: TAL, TALH, TAL-H, TALDOR
TALDO1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 006746
UniProt: P37837
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAY