SMN1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082517
Artikelname: SMN1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082517
Hersteller Artikelnummer: orb2082517
Alternativnummer: BYT-ORB2082517-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SMN
Konjugation: Biotin
Alternative Synonym: SMA, SMN, SMA1, SMA2, SMA3, SMA4, SMA , SMNT, BCD541, GEMIN1, TDRD16A, T-BCD541
SMN1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 32kDa
UniProt: Q16637
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASF