KRR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082709
Artikelname: KRR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082709
Hersteller Artikelnummer: orb2082709
Alternativnummer: BYT-ORB2082709-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KRR1
Konjugation: Biotin
Alternative Synonym: HRB2, RIP-1
KRR1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
UniProt: Q13601
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDN