GNB5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082769
Artikelname: GNB5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082769
Hersteller Artikelnummer: orb2082769
Alternativnummer: BYT-ORB2082769-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GBB5
Konjugation: Biotin
Alternative Synonym: GB5, IDDCA, LADCI, gbeta5
GNB5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 057278
UniProt: O14775
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MRSGQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVA