GCKR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082772
Artikelname: GCKR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082772
Hersteller Artikelnummer: orb2082772
Alternativnummer: BYT-ORB2082772-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GCKR
Konjugation: Biotin
Alternative Synonym: GKRP, FGQTL5
GCKR Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 001477
UniProt: Q14397
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAENIVRLLGQCDAE