ASF1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082907
Artikelname: ASF1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082907
Hersteller Artikelnummer: orb2082907
Alternativnummer: BYT-ORB2082907-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ASF1A
Konjugation: Biotin
Alternative Synonym: CIA, CGI-98, HSPC146
ASF1A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 054753
UniProt: Q9Y294
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSE