ACAT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082949
Artikelname: ACAT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082949
Hersteller Artikelnummer: orb2082949
Alternativnummer: BYT-ORB2082949-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-ACAT1 antibody is: synthetic peptide directed towards the middle region of Human THIL
Konjugation: Biotin
Alternative Synonym: T2, MAT, ACAT, THIL
ACAT1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 46 kDa
NCBI: 000010
UniProt: P24752
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVV