VAMP4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2082997
Artikelname: VAMP4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2082997
Hersteller Artikelnummer: orb2082997
Alternativnummer: BYT-ORB2082997-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human VAMP4
Konjugation: Biotin
Alternative Synonym: VAMP-4, VAMP24
VAMP4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 15 kDa
NCBI: 003753
UniProt: O75379
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKS