SQSTM1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2083057
| Artikelname: |
SQSTM1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2083057 |
| Hersteller Artikelnummer: |
orb2083057 |
| Alternativnummer: |
BYT-ORB2083057-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen for Anti-SQSTM1 antibody is: synthetic peptide directed towards the C-terminal region of Human SQSTM |
| Konjugation: |
Biotin |
| Alternative Synonym: |
p60, p62, A170, DMRV, OSIL, PDB3, ZIP3, p62B, NADGP, FTDALS3 |
| SQSTM1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
48 kDa |
| UniProt: |
Q13501 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: TQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGEL |