SOX11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083066
Artikelname: SOX11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083066
Hersteller Artikelnummer: orb2083066
Alternativnummer: BYT-ORB2083066-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOX11
Konjugation: Biotin
Alternative Synonym: CSS9, MRD27
SOX11 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 003099
UniProt: P35716
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPE