RFC5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083168
Artikelname: RFC5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083168
Hersteller Artikelnummer: orb2083168
Alternativnummer: BYT-ORB2083168-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RFC5
Konjugation: Biotin
Alternative Synonym: RFC36
RFC5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
UniProt: P40937
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYGPPGTGKTSTILA