PRUNE1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083195
Artikelname: PRUNE1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083195
Hersteller Artikelnummer: orb2083195
Alternativnummer: BYT-ORB2083195-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRUNE
Konjugation: Biotin
Alternative Synonym: PRUNE, DRES17, HTCD37, NMIHBA, DRES-17, H-PRUNE
PRUNE1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 42kDa
UniProt: Q86TP1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVD