PLOD2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083222
Artikelname: PLOD2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083222
Hersteller Artikelnummer: orb2083222
Alternativnummer: BYT-ORB2083222-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PLOD2
Konjugation: Biotin
Alternative Synonym: LH2, TLH, BRKS2
PLOD2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 81kDa
UniProt: O00469
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PIFSEKACDELVEEMEHYGKWSGGKHHDSRISGGYENVPTDDIHMKQVDL