KPNA2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083318
Artikelname: KPNA2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083318
Hersteller Artikelnummer: orb2083318
Alternativnummer: BYT-ORB2083318-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-KPNA2 antibody is: synthetic peptide directed towards the N-terminal region of Human IMA1
Konjugation: Biotin
Alternative Synonym: QIP2, RCH1, IPOA1, SRP1alpha, SRP1-alpha
KPNA2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 58 kDa
NCBI: 002257
UniProt: P52292
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINS