CREM Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083378
Artikelname: CREM Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083378
Hersteller Artikelnummer: orb2083378
Alternativnummer: BYT-ORB2083378-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CREM
Konjugation: Biotin
Alternative Synonym: ICER, CREM-2, hCREM-2
CREM Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 24kDa
UniProt: Q03060
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQ