COL13A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083384
Artikelname: COL13A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083384
Hersteller Artikelnummer: orb2083384
Alternativnummer: BYT-ORB2083384-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CODA1
Konjugation: Biotin
Alternative Synonym: CMS19, COLXIIIA1
COL13A1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 78kDa
UniProt: Q5TAT6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PGDKGERGAAGEQGPDGPKGSKGEPGKGEMVDYNGNINEALQEIRTLALM