CHAF1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2083396
| Artikelname: |
CHAF1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2083396 |
| Hersteller Artikelnummer: |
orb2083396 |
| Alternativnummer: |
BYT-ORB2083396-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CAF1A |
| Konjugation: |
Biotin |
| Alternative Synonym: |
CAF1, P150, CAF-1, CAF1B, CAF1P150 |
| CHAF1A Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
96kDa |
| UniProt: |
Q13111 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: EPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENH |
