AP1S2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2083414
Artikelname: AP1S2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2083414
Hersteller Artikelnummer: orb2083414
Alternativnummer: BYT-ORB2083414-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP1S2
Konjugation: Biotin
Alternative Synonym: PGS, DC22, MRX59, MRXS5, MRXSF, MRXS21, SIGMA1B
AP1S2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 17kDa
UniProt: P56377
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQE