PHC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084125
Artikelname: PHC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084125
Hersteller Artikelnummer: orb2084125
Alternativnummer: BYT-ORB2084125-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHC1
Konjugation: Biotin
Alternative Synonym: EDR1, HPH1, RAE28, MCPH11
PHC1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 004417
UniProt: P78364
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LLLLCVTHSQEDSSRCSDNSSYEEPLSPISASSSTSAGDKASGTWSSPTC