NFATC4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084200
Artikelname: NFATC4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084200
Hersteller Artikelnummer: orb2084200
Alternativnummer: BYT-ORB2084200-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NFATC4
Konjugation: Biotin
Alternative Synonym: NFAT3, NF-AT3, NF-ATC4
NFATC4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 86kDa
NCBI: 005267762
UniProt: Q14934
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PSIRITSISPTPEPPAALEDNPDAWGDGSPRDYPPPEGFGGYREAGGQGG