FANCC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084203
Artikelname: FANCC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084203
Hersteller Artikelnummer: orb2084203
Alternativnummer: BYT-ORB2084203-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FANCC
Konjugation: Biotin
Alternative Synonym: FA3, FAC, FACC
FANCC Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 001230672
UniProt: Q00597
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: INKEPQNSGQSKLNSWIQGVLSHILSALRFDKEVALFTQGLGYAPIDYYP