ADK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084281
Artikelname: ADK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084281
Hersteller Artikelnummer: orb2084281
Alternativnummer: BYT-ORB2084281-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADK
Konjugation: Biotin
Alternative Synonym: AK
ADK Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 006712
UniProt: P55263
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHK