CASP9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084320
Artikelname: CASP9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084320
Hersteller Artikelnummer: orb2084320
Alternativnummer: BYT-ORB2084320-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CASP9
Konjugation: Biotin
Alternative Synonym: MCH6, APAF3, APAF-3, PPP1R56, ICE-LAP6
CASP9 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 29kDa
UniProt: P55211
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSD