ANO1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084359
Artikelname: ANO1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084359
Hersteller Artikelnummer: orb2084359
Alternativnummer: BYT-ORB2084359-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANO1
Konjugation: Biotin
Alternative Synonym: DOG1, TAOS2, ORAOV2, TMEM16A
ANO1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 108kDa
NCBI: 060513
UniProt: Q5XXA6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPS