LAMP5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084365
Artikelname: LAMP5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084365
Hersteller Artikelnummer: orb2084365
Alternativnummer: BYT-ORB2084365-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LAMP5
Konjugation: Biotin
Alternative Synonym: LAMP-5, UNC-46, BADLAMP, BAD-LAMP, C20orf103
LAMP5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 036393
UniProt: Q9UJQ1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHK