IGF2BP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084374
Artikelname: IGF2BP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084374
Hersteller Artikelnummer: orb2084374
Alternativnummer: BYT-ORB2084374-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human IGF2BP2
Konjugation: Biotin
Alternative Synonym: IMP2, IMP-2, VICKZ2
IGF2BP2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 65kDa
UniProt: Q9Y6M1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIE