NFATC3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084383
Artikelname: NFATC3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084383
Hersteller Artikelnummer: orb2084383
Alternativnummer: BYT-ORB2084383-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NFATC3
Konjugation: Biotin
Alternative Synonym: NFAT4, NFATX, NF-AT4c
NFATC3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 81kDa
UniProt: Q12968
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQE