KRT17 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084413
Artikelname: KRT17 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084413
Hersteller Artikelnummer: orb2084413
Alternativnummer: BYT-ORB2084413-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT17
Konjugation: Biotin
Alternative Synonym: PC, K17, PC2, 39.1, CK-17, PCHC1
KRT17 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 000413
UniProt: Q04695
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATN