ZBTB8B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084440
Artikelname: ZBTB8B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084440
Hersteller Artikelnummer: orb2084440
Alternativnummer: BYT-ORB2084440-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZBTB8B
Konjugation: Biotin
Alternative Synonym: ZNF916B
ZBTB8B Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 001139192
UniProt: Q8NAP8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LVEASSESQEKSDTDNDWPIYVESGEENDPAGDDSDDKPQIQPNLSDRET