ZNF680 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084458
Artikelname: ZNF680 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084458
Hersteller Artikelnummer: orb2084458
Alternativnummer: BYT-ORB2084458-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZNF680
Konjugation: Biotin
ZNF680 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 848653
UniProt: Q8NEM1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IRIHTRENSYKCEECGKVLNWFSELIKHKGIHMGEKPYKCEECGKAFNQS