HSFX2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084524
Artikelname: HSFX2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084524
Hersteller Artikelnummer: orb2084524
Alternativnummer: BYT-ORB2084524-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human HSFX2
Konjugation: Biotin
Alternative Synonym: HSFX2,
HSFX2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 057237
UniProt: Q9UBD0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AGAAQPAASMVMFPHLPALHHHCPHSHRTSQYMPASDGPQAYPDYADQST