FAM189A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084545
Artikelname: FAM189A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084545
Hersteller Artikelnummer: orb2084545
Alternativnummer: BYT-ORB2084545-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human FAM189A1
Konjugation: Biotin
Alternative Synonym: TMEM228
FAM189A1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
UniProt: O60320
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AQLSPAGDPDTWKTDQRPTPEPFPATSKERPRSLVDSKAYADARVLVAKF